DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and pfdn5

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001016185.1 Gene:pfdn5 / 548939 XenbaseID:XB-GENE-1004349 Length:152 Species:Xenopus tropicalis


Alignment Length:145 Identity:59/145 - (40%)
Similarity:96/145 - (66%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPL 75
            ::.:::|.||..||..:|.:.:||:..:..|::.|...|.||..:||.|.....:.|.:|:||||
 Frog     2 AQTVNITDLSLPQLEGLKSQLDQEVEFLSSSIAQLKVVQTKYVEAKECLSVLNKSNEGKQLLVPL 66

  Fly    76 TSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSV 140
            ||||||||.:.|::..:||:|||||:||.:|.:||:|||:||::.:|||||:....:|.....:|
 Frog    67 TSSMYVPGTLNDVSNILIDVGTGYYVEKTVEDAKDFFKRKVEFLTKQIEKIQPALQEKHAMKQAV 131

  Fly   141 MSVLEMK--QAAAAK 153
            :.::.:|  |.:.||
 Frog   132 IEMMSIKIQQLSVAK 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 53/129 (41%)
pfdn5NP_001016185.1 TIGR00293 12..136 CDD:129394 52/123 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1972
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449403at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.