DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and PFDN5

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_002615.2 Gene:PFDN5 / 5204 HGNCID:8869 Length:154 Species:Homo sapiens


Alignment Length:153 Identity:55/153 - (35%)
Similarity:96/153 - (62%) Gaps:0/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPL 75
            ::.|::|:|:..||..:|.:.:||:..:..|::.|...|.||..:|:.|.....:.|.:::||||
Human     2 AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPL 66

  Fly    76 TSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSV 140
            ||||||||::.|:...:||:|||||:||..|.:||:|||:::::.:|:|||:....:|.....:|
Human    67 TSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAV 131

  Fly   141 MSVLEMKQAAAAKLQSQQQSQPA 163
            |.::..|......|.:.|.:..|
Human   132 MEMMSQKIQQLTALGAAQATAKA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 49/127 (39%)
PFDN5NP_002615.2 TIGR00293 12..138 CDD:129394 48/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159326
Domainoid 1 1.000 102 1.000 Domainoid score I6824
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1972
Inparanoid 1 1.050 115 1.000 Inparanoid score I4830
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54008
OrthoDB 1 1.010 - - D1449403at2759
OrthoFinder 1 1.000 - - FOG0005548
OrthoInspector 1 1.000 - - oto89364
orthoMCL 1 0.900 - - OOG6_101532
Panther 1 1.100 - - LDO PTHR12674
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R908
SonicParanoid 1 1.000 - - X3967
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.