DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and CG15676

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001286689.1 Gene:CG15676 / 37472 FlyBaseID:FBgn0034651 Length:182 Species:Drosophila melanogaster


Alignment Length:138 Identity:25/138 - (18%)
Similarity:59/138 - (42%) Gaps:27/138 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQ 70
            :.||..:|   .:|...|..::..:.|.::|.|...|..     ||  .:.|.:..|..| .:::
  Fly    43 TVPAALKM---QRLFYVQYSELAAKLETDLTAVLTRLEA-----AK--NNLELVRRFIDN-PDKE 96

  Fly    71 I--LVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKR--------------RVEYV 119
            :  ||.:...::....:..:.:..:.:|....:|.:|..::::.|:              .::|:
  Fly    97 VHSLVQIAQGVFRWVSIPPVQKVTLQVGASLQMEFELSEAEEFIKKDITSLVKQQLQHEHDIDYL 161

  Fly   120 QEQIEKIE 127
            |:|:..||
  Fly   162 QDQVNTIE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 21/123 (17%)
CG15676NP_001286689.1 Prefoldin_alpha 45..177 CDD:238327 25/136 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101532
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.