DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and F35H10.6

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_501397.2 Gene:F35H10.6 / 177625 WormBaseID:WBGene00018071 Length:158 Species:Caenorhabditis elegans


Alignment Length:118 Identity:23/118 - (19%)
Similarity:50/118 - (42%) Gaps:15/118 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPNWENRQILVPL 75
            ||.:...|::.|:     :||::.....::.......||...   .||..|.:...|       |
 Worm    19 SENVIHPKIATEE-----KEFKKLQKQCEEYAKLKFTCQRLL---NEAPKTTEGKTE-------L 68

  Fly    76 TSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEK 128
            ...:::...|:|....|:.:....|:|..|:.:.....|:::.::..:||::|
 Worm    69 GQRVFMNIEVRDTKHVVVKLCDDVYVEMKLQDAIKTCDRKMDSLKNMMEKLQK 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 20/108 (19%)
F35H10.6NP_501397.2 Prefoldin_alpha 15..141 CDD:238327 23/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12674
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.