DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn5 and pfd-5

DIOPT Version :9

Sequence 1:NP_001163688.1 Gene:Pfdn5 / 42647 FlyBaseID:FBgn0038976 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_498582.1 Gene:pfd-5 / 176013 WormBaseID:WBGene00020112 Length:152 Species:Caenorhabditis elegans


Alignment Length:159 Identity:49/159 - (30%)
Similarity:84/159 - (52%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAATPSAPAKSEMIDLTKLSPEQLIQIKQEFEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPN 65
            ||..|..      :.|::||.:||.::::..|||:...|:|.:.|.|...:...|..||...:..
 Worm     1 MAEEPKG------VPLSELSLQQLGELQKNCEQELNFFQESFNALKGLLTRNEKSISALDDVKIA 59

  Fly    66 WENRQILVPLTSSMYVPGRVKDLNRFVIDIGTGYYIEKDLEGSKDYFKRRVEYVQEQIEKIEKIH 130
            ......|:||:.|:|:...:.|.::.:::|||||::|.|.|.:|..|.|:.|::.:|:|.:|.|.
 Worm    60 TAGHTALIPLSESLYIRAELSDPSKHLVEIGTGYFVELDREKAKAIFDRKKEHITKQVETVEGIL 124

  Fly   131 LQK--TRFYNSVMSVLEMKQAAAAKLQSQ 157
            .:|  ||.|        :..|...|:|||
 Worm   125 KEKRRTRAY--------ISDAFQTKVQSQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn5NP_001163688.1 Prefoldin_alpha 21..149 CDD:238327 38/129 (29%)
pfd-5NP_498582.1 TIGR00293 15..141 CDD:129394 39/133 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166940
Domainoid 1 1.000 68 1.000 Domainoid score I6413
eggNOG 1 0.900 - - E1_COG1730
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3814
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54008
OrthoDB 1 1.010 - - D1449403at2759
OrthoFinder 1 1.000 - - FOG0005548
OrthoInspector 1 1.000 - - oto19244
orthoMCL 1 0.900 - - OOG6_101532
Panther 1 1.100 - - LDO PTHR12674
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R908
SonicParanoid 1 1.000 - - X3967
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.