DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and pros1

DIOPT Version :9

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:NP_001119539.1 Gene:pros1 / 733989 XenbaseID:XB-GENE-980521 Length:673 Species:Xenopus tropicalis


Alignment Length:522 Identity:100/522 - (19%)
Similarity:186/522 - (35%) Gaps:156/522 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 RFNKARRRRRSEQVPPVV-VEYRRSYRVLIVSALLVSLAASFVTLSAGFQL-DGSQNSFYTFRKW 120
            ::..|:.:...|.:|..| :....:|.:|.::.....:...::.    |:| |.|:.|       
 Frog   274 KYKLAQDQTSCESIPVCVPLNLETNYELLYLAEQFTGIPVVYLR----FKLPDVSRFS------- 327

  Fly   121 YTGLNGTLELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRLRYNLGGGAQIITVGRELHDGH 185
                   .|.:|:|....|::||.:...:..:|.|.|.:|.:.:::......::.|.|:.:::|.
 Frog   328 -------AEFDFRTYDGEGVILYAESADSTSWFLLALRDGKIEIQFKNELWTKVTTGGKAINNGE 385

  Fly   186 WHKVQVLRNDEQTSLI--------VDGVSQQRSTKGKEFQFGKFASNSDVYVGGMPNWYSSKLAL 242
            ||.:.|   :|..::|        |..::..||.    |:.......:.||:.|:|.    |:..
 Frog   386 WHIITV---EELENIISVKIAKEAVMNINNPRSL----FKPANGILETKVYIAGLPR----KIEN 439

  Fly   243 LALPSVIFEPRFRGAIR--NLVYADQPGGSTRRQEIKQQRDIKCGDVPCDHGELPARERPLRGVR 305
            :..|   ..||..|.||  ||:                           :.|.|..:| .::|.:
 Frog   440 IIKP---INPRLDGCIRGWNLM---------------------------NQGALGVKE-VIQGKQ 473

  Fly   306 GGNTTDACERNDPCQHGGICISTDSGPICECRNLEYDGQYCEKEKAPSEATFRGTQFLSYDLGQT 370
            ..:...:.||......||:                              |.|    |::|: ..|
 Frog   474 SKHCLVSVERGSYYPGGGV------------------------------ARF----FMNYN-DST 503

  Fly   371 GAEPIVSAQDAISFYFRTRQPNGLLFYTGHG-TDYLNLALRDGGVSLTMGLANGKQEMHIKPSKV 434
            ..|...:    |:...|:....|::|...:| |..|.:|:.|.......|:.     :.|     
 Frog   504 NGEWFAN----ITLNIRSSTGIGVMFSLVNGETVPLAIAIEDLASDFLQGIV-----VSI----- 554

  Fly   435 RFDDHQWHKVTVHRRIQE---------IS-SITSFCRLVTV---VDDVYTDHSHIAGKFTMLSSS 486
                   |.|||.|...:         || |:|....::|.   .|..|...:.:..:.::|..:
 Frog   555 -------HSVTVARLTTKRICTDKNLLISVSVTKSSLVLTANSYTDITYASQAELEKQLSVLDQA 612

  Fly   487 R-----VYVGGAVNPRALLGARVHTNFVGCLRKVEFSADTLNLNLIDLAKSGSKLIQVAGNLEYQ 546
            .     .|:||......:....|...:|||:..      |:|..|:||..:.||...:.   .:.
 Frog   613 MRENPDTYLGGIPADIPVAATPVSAYYVGCMDV------TINNQLMDLDGAISKQNDIR---SHS 668

  Fly   547 CP 548
            ||
 Frog   669 CP 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058 37/162 (23%)
EGF_CA 311..347 CDD:238011 4/35 (11%)
Laminin_G_2 386..517 CDD:280389 30/149 (20%)
LamG 555..716 CDD:238058
EGF 746..777 CDD:278437
Laminin_G_2 814..945 CDD:280389
LamG 988..1136 CDD:238058
EGF 1164..1195 CDD:278437
Laminin_G_2 1233..1356 CDD:280389
pros1NP_001119539.1 GLA 24..86 CDD:214503
EGF_CA 121..156 CDD:238011
FXa_inhibition 168..201 CDD:291342
EGF_CA 203..243 CDD:284955
vWFA <241..281 CDD:294047 1/6 (17%)
LamG 315..457 CDD:238058 38/173 (22%)
LamG 484..648 CDD:238058 40/225 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.