DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and SHBG

DIOPT Version :9

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:NP_001031.2 Gene:SHBG / 6462 HGNCID:10839 Length:402 Species:Homo sapiens


Alignment Length:435 Identity:91/435 - (20%)
Similarity:150/435 - (34%) Gaps:137/435 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 GAEPIV--------SAQDAISFYFRTRQPNGLLFY--TGHGTDYLNLALRDG---------GVSL 416
            |.|||.        ..:.:.||..||..|.|::||  |....|:..|.||||         ...|
Human    52 GQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQL 116

  Fly   417 TMGLANGKQEMHIKPSKVRFDDHQWHKVTVHRRIQEISSITSFCRLVTVVDDVYTDHSHIAGKFT 481
            |:|            :..|.||.:||:|.|.   .|..|:     |:.|..:.......::|..|
Human   117 TVG------------AGPRLDDGRWHQVEVK---MEGDSV-----LLEVDGEEVLRLRQVSGPLT 161

  Fly   482 MLSS--SRVYVGGAVNPRALLGARVHTNFVGCLRK-------VEFSADTLNLNLIDLAKSGSKLI 537
            ....  .|:.:||.:.|.:.|...:.....||||:       .|.||.         |.:..:..
Human   162 SKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISAS---------APTSLRSC 217

  Fly   538 QVAGNLEYQCPSGDPQDPVTFTTRESHLVLP-----PWETGKQSSISFKFRTKEPNG---IIVLA 594
            .|..|.....|.|...:   |..|:    :|     ||      :.|.....|:..|   ::.|.
Human   218 DVESNPGIFLPPGTQAE---FNLRD----IPQPHAEPW------AFSLDLGLKQAAGSGHLLALG 269

  Fly   595 TGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGAS---------KVRASRRRVDDGDWHDLILRRN 650
            |      .:||..:::.|.:..:.:....|.|..         :::.|..||        :|.:.
Human   270 T------PENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRV--------VLSQG 320

  Fly   651 GRDAKVSVDGVWNDFRTPGDGTILEL----DGHMYLGGVGPAYNSVSWPAAIWTATLRQGFVGCL 711
            .:...:::..:       |...:|.|    .|.::||.:....:|.|:               ||
Human   321 SKMKALALPPL-------GLAPLLNLWAKPQGRLFLGALPGEDSSTSF---------------CL 363

  Fly   712 RDLVLSGKAIDIAAFARVQDSASVKPSCHVQANVCNGNPCLNGGT 756
            ..|...|:.:|:       |.| :..|..:..:.|..:|  ..||
Human   364 NGLWAQGQRLDV-------DQA-LNRSHEIWTHSCPQSP--GNGT 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:280389 38/150 (25%)
LamG 555..716 CDD:238058 30/181 (17%)
EGF 746..777 CDD:278437 4/11 (36%)
Laminin_G_2 814..945 CDD:280389
LamG 988..1136 CDD:238058
EGF 1164..1195 CDD:278437
Laminin_G_2 1233..1356 CDD:280389
SHBGNP_001031.2 Laminin_G_1 75..205 CDD:278483 38/149 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.