DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and CG6763

DIOPT Version :9

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster


Alignment Length:346 Identity:74/346 - (21%)
Similarity:124/346 - (35%) Gaps:99/346 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1082 VDDSFEIISLTGNNMHLELAGILYIGGVFKDMYSKLPAS-----------ISSRSG-FEGCLASL 1134
            |||: |:|.|.||.:. |:...|     .||:....|..           .::|.| |     |.
  Fly    27 VDDT-EVIELPGNGIE-EIPPTL-----GKDIIDLTPLGTALFGKPDEELTANRVGNF-----SA 79

  Fly  1135 DLGDASPS-----LTSDAVVPSSLVVSGCEGPTKCSQ--------------NA--CANRGNCVQQ 1178
            |..:.:|.     |..|.:||.:.::.....||:.|:              ||  .|...|.:.:
  Fly    80 DADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARDMATIENAIGE 144

  Fly  1179 WNAYAC--------ECDMTSYTGPT--CYDESIAYEFGNNKGMVQ----YTFPENAQADTEEDNI 1229
            ::...|        |.|..|..|..  |: .|:....|..:..:|    .:.|..|..:...   
  Fly   145 YHRRTCIRFVKRSSERDYISIRGDNSGCW-SSVGRVGGKQEVNLQSPGCLSRPGTAMHELMH--- 205

  Fly  1230 ALGFI-----TTRPDAVLLR---VESATTQDYMELEIVEGNIFMV-YNIGSVDLPLGEIGTKVND 1285
            ||||:     ..|...|.::   |:|:...::.:....|.  |.| |:.|||        ...:.
  Fly   206 ALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEKAARTEA--FGVPYDYGSV--------MHYSK 260

  Fly  1286 NAYH------VVRFQRKGGNATLQ---LDDYNVQALTPQSHHSTVFNTM-------SNVQVGGKF 1334
            ||:.      ::..|..|.:...|   ..||::|.|.......|| |.:       :.....|..
  Fly   261 NAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDCGTV-NAVPVAPGLPAPAPAPGAP 324

  Fly  1335 SRNGRNRIERPFAGVIAGLSV 1355
            :.:|...::....|:|:||.:
  Fly   325 AGSGNPIVDSFIGGLISGLGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:280389
LamG 555..716 CDD:238058
EGF 746..777 CDD:278437
Laminin_G_2 814..945 CDD:280389
LamG 988..1136 CDD:238058 17/65 (26%)
EGF 1164..1195 CDD:278437 10/54 (19%)
Laminin_G_2 1233..1356 CDD:280389 30/148 (20%)
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 39/201 (19%)
ZnMc_astacin_like 119..300 CDD:239807 39/194 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444948
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.