DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Nrx-1 and CG6974

DIOPT Version :9

Sequence 1:	NP_001262840.1	Gene:	Nrx-1 / 42646	FlyBaseID:	FBgn0038975	Length:	1847	Species:	Drosophila melanogaster
Sequence 2:	NP_650414.1	Gene:	CG6974 / 41815	FlyBaseID:	FBgn0038285	Length:	251	Species:	Drosophila melanogaster

Alignment Length:	99	Identity:	20/99 - (20%)
Similarity:	35/99 - (35%)	Gaps:	40/99 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   885 QVDGAPPV----------------------------RGMLSETILGRHSTMEIRSVHLGGLFH-- 919
            :::||||.                            ..:|:|..|...:.::..::||.||||
  Fly    95 EIEGAPPAGKRYVSFKKSPNMCGTRVGYQPLSFGPHEVVLNEKCLTMPAVIQHETLHLLGLFHEQ 159

  Fly   920 ----AEEEIQMT-STMP-----NFVGQMQGLVFN 943
                .:|.:|:. ..:|     .|:...|...||
  Fly   160 SRPDRDEYVQIDYDNIPRKYWSQFMAMDQTTTFN 193

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Nrx-1	NP_001262840.1	LamG	110..263	CDD:238058
		EGF_CA	311..347	CDD:238011
		Laminin_G_2	386..517	CDD:280389
		LamG	555..716	CDD:238058
		EGF	746..777	CDD:278437
		Laminin_G_2	814..945	CDD:280389	20/99 (20%)
		LamG	988..1136	CDD:238058
		EGF	1164..1195	CDD:278437
		Laminin_G_2	1233..1356	CDD:280389
CG6974	NP_650414.1	Astacin	55..251	CDD:279708	20/99 (20%)
CG6974	NP_650414.1	ZnMc_astacin_like	59..249	CDD:239807	20/99 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45444950
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930