DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and CG7631

DIOPT Version :9

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster


Alignment Length:297 Identity:67/297 - (22%)
Similarity:97/297 - (32%) Gaps:91/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 APHSATYQDNYADAAMTA-RTRPSMDMDQQRNRNQAELRLLPAQRTSTSAFESPDLRFNKARRRR 66
            ||.:..|.:  .|..:|| ..:..||:|..||...:|.|..|                |.....|
  Fly    21 APFNTHYDE--TDPELTAGYFQGDMDVDYARNGQLSETRRWP----------------NATVPYR 67

  Fly    67 RSEQVPPVVVEYRRSYRVLIVSALLVSLAASFVTLSAGFQL----DGSQNSFYTFRKWYTGLNGT 127
            .||:.....|||             :.|...|:..|:..:.    :..:|..:...         
  Fly    68 ISEEFDAPHVEY-------------IKLGMQFIEYSSCIRFVPADEDEENYLFVLP--------- 110

  Fly   128 LELEFKTEQPNGLVLYTDDGGTYDFFELKLVEGALRLR-YNLGGGAQIITVGRE-LHDGHWHKVQ 190
                 .|...:..|.|.....|     :||..|:|... :.||      |:..| ||...:|..|
  Fly   111 -----STSGCSSKVGYQPGERT-----VKLKPGSLDTGCFKLG------TIQHELLHTLGFHHQQ 159

  Fly   191 VLRN-DEQTSLIVDGVSQQRSTKGKEFQFGKFASNSDVYVG--GMPNWYSSKLALLALPSVIFEP 252
            ...| ||...::.:.:|:     |.|..|.|:..:.   ||  ..|..|.|   :|...|:.|..
  Fly   160 CSPNRDEFVKIVEENISE-----GHEKNFVKYEEDE---VGDFDQPYDYGS---ILHYSSLAFSI 213

  Fly   253 RFRGAIRNLVYADQPGGSTRRQEIKQQR------DIK 283
            .....|    .|..|.|    ||...||      |:|
  Fly   214 NGEATI----VALNPEG----QEQMGQRLMMSDTDVK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058 34/157 (22%)
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:280389
LamG 555..716 CDD:238058
EGF 746..777 CDD:278437
Laminin_G_2 814..945 CDD:280389
LamG 988..1136 CDD:238058
EGF 1164..1195 CDD:278437
Laminin_G_2 1233..1356 CDD:280389
CG7631NP_609760.1 Astacin 57..251 CDD:279708 55/259 (21%)
ZnMc_astacin_like 61..248 CDD:239807 53/239 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.