DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and CG11865

DIOPT Version :10

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster


Alignment Length:177 Identity:38/177 - (21%)
Similarity:60/177 - (33%) Gaps:46/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IDLAKSGSKLIQVAG-------NLEYQCPSGDPQDPVTFTTRESHLVLPPWETGKQSSISFKFRT 584
            :|:|...|.:.:::.       ..||:              ||..:|:....:|..|.:.:..|.
  Fly    72 LDIASIESAMAEISSKTCVKFRRTEYK--------------REPQVVIQKEGSGCWSYVGYLGRA 122

  Fly   585 KEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASK-VRASRRRVDDGDWHDL-IL 647
            .:   .:.|.:|....|.     |..|||:...:.|........| ||.....:..|..|:. .|
  Fly   123 DQ---TLNLGSGCMSNRT-----IQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRL 179

  Fly   648 RRNGRDAKVSVDGVWND-----------FRTPGDGTILELDGHMYLG 683
            |.||    |:..|...|           |...|..||:.|..|..:|
  Fly   180 RANG----VTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSHAKIG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:460494
LamG 555..716 CDD:238058 33/142 (23%)
EGF 746..777 CDD:394967
Laminin_G_2 814..945 CDD:460494
Laminin_G_2 1010..1138 CDD:460494
Laminin_G_2 1233..1356 CDD:460494
CG11865NP_609759.1 ZnMc_astacin_like 58..239 CDD:239807 38/177 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.