DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and CG15253

DIOPT Version :9

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:195 Identity:40/195 - (20%)
Similarity:82/195 - (42%) Gaps:61/195 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 YRVLIVSALLVSLAASFVT--------LSAGFQLDGS-----------QNSFYTFRKW-----YT 122
            |.:|::..::|::|.:..:        |:||: ::|.           :|..|   :|     |.
  Fly     4 YSILLLLLVVVNVAWAAPSIRIETDPELTAGY-IEGDMVPSGSSRNIWRNETY---RWPNRIIYY 64

  Fly   123 GLNGTLE-------------------LEFK---TEQPNGLVLYTDDGGTYDFF-ELKLVEGALRL 164
            .:|..::                   |.||   |:|...:.:.:::||.:.:. .|..|: .|.|
  Fly    65 HINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQ-QLNL 128

  Fly   165 RYN-LGGGA-QIITVGRE-LHD-GHWHKVQVLRNDEQTSLIVDGVSQQRSTKGKEFQFGKFASNS 225
            :.| :|.|. ::.|:..| ||. |.:|:......|:...::.:.:     |:|.||.|.|:...:
  Fly   129 QNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENI-----TEGMEFNFDKYTEET 188

  Fly   226  225
              Fly   189  188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058 32/159 (20%)
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:280389
LamG 555..716 CDD:238058
EGF 746..777 CDD:278437
Laminin_G_2 814..945 CDD:280389
LamG 988..1136 CDD:238058
EGF 1164..1195 CDD:278437
Laminin_G_2 1233..1356 CDD:280389
CG15253NP_609758.1 Astacin 55..250 CDD:279708 31/143 (22%)
ZnMc_astacin_like 59..246 CDD:239807 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444940
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.