DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and CG6696

DIOPT Version :10

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster


Alignment Length:104 Identity:25/104 - (24%)
Similarity:39/104 - (37%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   635 RRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTILELDG----------HMYLGGVGPAY 689
            |..:.||.|.|:::.|       ..|.|:.......|.:|.|:.          |..|..:| .|
  Fly   143 RPYEQGDKHWLLIKGN-------YSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALG-FY 199

  Fly   690 NSVSWPAAIWTATLRQGFVGCLRDLVLSGKAIDIAAFAR 728
            :..|       ||.|..:|....:.:|.|.|.:...:||
  Fly   200 HQQS-------ATERDEYVKINWENILDGHAHNFNKYAR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:460494
LamG 555..716 CDD:238058 20/90 (22%)
EGF 746..777 CDD:394967
Laminin_G_2 814..945 CDD:460494
Laminin_G_2 1010..1138 CDD:460494
Laminin_G_2 1233..1356 CDD:460494
CG6696NP_573318.1 ZnMc_astacin_like 110..289 CDD:239807 25/104 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.