DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrx-1 and slc7a14

DIOPT Version :9

Sequence 1:NP_001262840.1 Gene:Nrx-1 / 42646 FlyBaseID:FBgn0038975 Length:1847 Species:Drosophila melanogaster
Sequence 2:XP_002931595.1 Gene:slc7a14 / 100493085 XenbaseID:XB-GENE-1010371 Length:768 Species:Xenopus tropicalis


Alignment Length:299 Identity:60/299 - (20%)
Similarity:104/299 - (34%) Gaps:98/299 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   468 DVYTDHSHIAGKFTMLSSS----RVYVGGAVNPR-----------------ALLGARVHTNFVGC 511
            :::..|...|.||.:...|    .|.:.|::.|.                 |.:.:...|..|.|
 Frog   323 EMFVVHGFYAAKFVVAVGSVAGLTVSLFGSLFPMPRVIYAMAGDGLLFKFLAHVSSYTETPVVAC 387

  Fly   512 LRKVEFSADTLNL-----NLIDLAKSGSKLIQVAGN-----LEYQCPSGDPQDPVTFTTRESHLV 566
            :.. .|.|..|:|     :||::...|:.|.....:     |.|| |..|....|.|.:.|:   
 Frog   388 VVS-GFLAGLLSLLVSLRDLIEMMSIGTLLAYTLVSVCVLLLRYQ-PESDIDGFVKFISEEN--- 447

  Fly   567 LPPWETGKQSSISFKFRTKEPNGIIVLATGSKQPRAKNPVLIAIELLNGHIYIHLDLGSGASKVR 631
                             ||:..||  ||...|.  |.:|      :.:|.     :....|:...
 Frog   448 -----------------TKKKEGI--LADCEKD--ACSP------MSDGE-----EFSGPATNTC 480

  Fly   632 ASRRRVDDGDWHDLILRRNGRDAKVSVDGVWNDFRTPGDGTI-----LELDG--HMYL----GGV 685
            .::.....|| :::::.::        |....:...|..||:     :|.||  :.||    ..:
 Frog   481 GAKNLPSLGD-NEMLIGKS--------DKSHYNINHPNYGTVDMTSGIEADGSENRYLFKIKKFI 536

  Fly   686 GPAYNSVSWPAAIWTATLRQGFVGCL-RDLVLSGKAIDI 723
            ||.|         :|..:|.|..|.: |....:|:.:.|
 Frog   537 GPRY---------YTLRIRLGLPGKMDRPTAATGRTVTI 566

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nrx-1NP_001262840.1 LamG 110..263 CDD:238058
EGF_CA 311..347 CDD:238011
Laminin_G_2 386..517 CDD:280389 12/69 (17%)
LamG 555..716 CDD:238058 33/172 (19%)
EGF 746..777 CDD:278437
Laminin_G_2 814..945 CDD:280389
LamG 988..1136 CDD:238058
EGF 1164..1195 CDD:278437
Laminin_G_2 1233..1356 CDD:280389
slc7a14XP_002931595.1 2A0303 20..676 CDD:273330 60/299 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7419
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.890

Return to query results.
Submit another query.