DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pebp1 and AT5G01300

DIOPT Version :10

Sequence 1:NP_651051.1 Gene:Pebp1 / 42644 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_195750.1 Gene:AT5G01300 / 830983 AraportID:AT5G01300 Length:162 Species:Arabidopsis thaliana


Alignment Length:109 Identity:29/109 - (26%)
Similarity:41/109 - (37%) Gaps:38/109 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PNSLYTILLV--DPDAPSREDPKFRELLHWLVINIP--------GNKVSEGQTIAEYIGAGPREG 106
            |....|:.||  |.|||....|.....: |:|::||        |...:|.||      .|.|||
plant    44 PEGTKTLALVVEDIDAPDPSGPLVPWTV-WVVVDIPPEMKGLPEGYSGNEDQT------TGIREG 101

  Fly   107 TG---------------LHRYVFLVFKQNDK------ITTEKFV 129
            ..               .||:.|.:|..:||      :|.|:.:
plant   102 NNDHKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGHTVTKERLL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 29/109 (27%)
AT5G01300NP_195750.1 PEBP 6..159 CDD:441485 29/109 (27%)

Return to query results.
Submit another query.