DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7054 and ybcL

DIOPT Version :10

Sequence 1:NP_651050.1 Gene:CG7054 / 42643 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_415077.1 Gene:ybcL / 945165 ECOCYCID:G6301 Length:183 Species:Escherichia coli


Alignment Length:138 Identity:40/138 - (28%)
Similarity:59/138 - (42%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EVKQGNELTPTQV---------KDQPIVSWSGLEGKSNLLTLLMVDPDAPTRQDPKYREILHWSV 81
            |:|.|.:||.:.|         ...|.::|||:...:....:.:.||||||...     ..||:|
E. coli    28 EIKTGEQLTTSHVFSGFGCEGGNTSPSLTWSGVPEGTKSFAVTVYDPDAPTGSG-----WWHWTV 87

  Fly    82 VNIPGS-------------NENPSG---GHSLADYVGSG---PPKDTGLHRYIFLLYRQENKIEE 127
            ||||.:             .:.|:|   |.:...|.|.|   |||....|.|.|.::..  |.|:
E. coli    88 VNIPATVTYLPVDAGRRDGTKLPTGAVQGRNDFGYAGFGGACPPKGDKPHHYQFKVWAL--KTEK 150

  Fly   128 TPTISNTT 135
            .|..||::
E. coli   151 IPVDSNSS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 40/138 (29%)
ybcLNP_415077.1 PRK09818 1..183 CDD:182092 40/138 (29%)

Return to query results.
Submit another query.