DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7054 and BFT

DIOPT Version :10

Sequence 1:NP_651050.1 Gene:CG7054 / 42643 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_201010.1 Gene:BFT / 836324 AraportID:AT5G62040 Length:177 Species:Arabidopsis thaliana


Alignment Length:165 Identity:57/165 - (34%)
Similarity:91/165 - (55%) Gaps:14/165 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IVPDVLDAV-PAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLEGKSNLLTLLMVDPDAPT 67
            ::.|||:.. |:.|::|.:..:..|..|:||.|:.:..:|.|...|.:.:| ..||:|:|||||:
plant    13 VIGDVLEMFNPSVTMRVTFNSNTIVSNGHELAPSLLLSKPRVEIGGQDLRS-FFTLIMMDPDAPS 76

  Fly    68 RQDPKYREILHWSVVNIPGSNENPSGGHSLADYVGSGPPKDTGLHRYIFLLYRQENK--IEETPT 130
            ..:|..||.|||.|.:|||:.: .|.|..:..|  ..|....|:|||:|.|::|..:  ::..|.
plant    77 PSNPYMREYLHWMVTDIPGTTD-ASFGREIVRY--ETPKPVAGIHRYVFALFKQRGRQAVKAAPE 138

  Fly   131 ISNTTRTGRLNFNARDFAAKHGLGEPIAANYYQAQ 165
            .       |..||...|::..||.:|:||.|:.||
plant   139 T-------RECFNTNAFSSYFGLSQPVAAVYFNAQ 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 51/150 (34%)
BFTNP_201010.1 PEBP 1..169 CDD:469671 57/165 (35%)

Return to query results.
Submit another query.