DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7054 and AT5G01300

DIOPT Version :10

Sequence 1:NP_651050.1 Gene:CG7054 / 42643 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_195750.1 Gene:AT5G01300 / 830983 AraportID:AT5G01300 Length:162 Species:Arabidopsis thaliana


Alignment Length:137 Identity:37/137 - (27%)
Similarity:54/137 - (39%) Gaps:29/137 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KD-QPIVSWSGLEGKSNLLTLLMVDPDAPTRQDPKYREILHWSVVNIP----------GSNENPS 92
            || .|.:.|..:...:..|.|::.|.|||....|.....: |.||:||          ..||:.:
plant    32 KDISPPLEWYNVPEGTKTLALVVEDIDAPDPSGPLVPWTV-WVVVDIPPEMKGLPEGYSGNEDQT 95

  Fly    93 GG-------HSLADYVGSGPPKDTGLHRYIFLLYRQENKIEETPTISNTTRTGRLNFNARDFAAK 150
            .|       |.:..:  .||...:..||:.|.|:..::|    |.|.:|....||......    
plant    96 TGIREGNNDHKIPGW--RGPLLPSHGHRFQFKLFALDDK----PKIGHTVTKERLLIAIEG---- 150

  Fly   151 HGLGEPI 157
            |.|||.|
plant   151 HVLGEAI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 37/137 (27%)
AT5G01300NP_195750.1 PEBP 6..159 CDD:441485 37/137 (27%)

Return to query results.
Submit another query.