DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7054 and ATC

DIOPT Version :10

Sequence 1:NP_651050.1 Gene:CG7054 / 42643 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_180324.1 Gene:ATC / 817302 AraportID:AT2G27550 Length:175 Species:Arabidopsis thaliana


Alignment Length:171 Identity:61/171 - (35%)
Similarity:88/171 - (51%) Gaps:28/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DIVPDVLDAVPAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLEGKSNLLTLLMVDPDAPT 67
            |:|.:.|.||   .:.|.|..|.:|..|:||.|:.|..:|.|...|.:.:| ..||:|.|||.|.
plant    17 DVVDNCLQAV---KMTVTYNSDKQVYNGHELFPSVVTYKPKVEVHGGDMRS-FFTLVMTDPDVPG 77

  Fly    68 RQDPKYREILHWSVVNIPGSNENPSGGHSLADYVGSGPPKDTGLHRYIFLLYRQENKIEETPTIS 132
            ..||..||.|||.|.:|||:.: .|.|..:..|  ..|..:.|:||:::||::|           
plant    78 PSDPYLREHLHWIVTDIPGTTD-VSFGKEIIGY--EMPRPNIGIHRFVYLLFKQ----------- 128

  Fly   133 NTTRTG--------RLNFNARDFAAKHGLGEPIAANYYQAQ 165
              ||.|        |..||.|:||.::.||.|:||.::..|
plant   129 --TRRGSVVSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 55/156 (35%)
ATCNP_180324.1 PEBP 7..175 CDD:469671 61/171 (36%)

Return to query results.
Submit another query.