DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2mu and HAP13

DIOPT Version :9

Sequence 1:NP_001163686.1 Gene:AP-2mu / 42642 FlyBaseID:FBgn0263351 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_176277.1 Gene:HAP13 / 842372 AraportID:AT1G60780 Length:428 Species:Arabidopsis thaliana


Alignment Length:443 Identity:163/443 - (36%)
Similarity:262/443 - (59%) Gaps:35/443 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHAR--QQVRSPVTNIARTSFFHIKRANIWLAA 67
            ||:.:.||.||:.|.||.|:.....:.|...:|...  .|...||......::..::.:|::|..
plant     8 LFLLDIKGRVLVWRDYRGDVSAAQAERFFTKLIEKEGDSQSNDPVAYDNGVTYMFVQHSNVYLMI 72

  Fly    68 VTKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGYPQNTDSGTLKTF 132
            .::||.|||.:..||.::::|.:.||.::.||::::|||::||||||::||||||.|::..|..|
plant    73 ASRQNCNAASLLFFLHRVVDVFKHYFEELEEESLRDNFVVVYELLDEMMDFGYPQYTEARILSEF 137

  Fly   133 ITQQGIKSATKEEQMQITSQ----VTGQIGWRREGIKYRRNELFLDVLEYVNLLMSPQGQVLSAH 193
            |       .|...:|::|.:    ||..:.||.|||:|::||:||||:|.||:|::..||::.:.
plant   138 I-------KTDAYRM
EVTQRPPMAVTNAVSWRSEGIQYKKNEVFLDVIENVNILVNSNGQIVRSD 195

  Fly   194 VAGKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGNSEAETSRSGKPVVVIDDCQFHQCVKLSK 258
            |.|.:.|::||:||||||.|:||::::|::||...|.:           :.::|.:|||||:|::
plant   196 VVGALKMRTYLTGMPECKLGLNDRVLLEAQGRATKGKA-----------IDLEDIKFHQCVRLAR 249

  Fly   259 FETEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRTKMEVKVVLKSNFKPSLLGQKIE 323
            ||.:.:||||||||.|:||.||.:..:.....|...:....|:::|:.:..:|.||.......:|
plant   250 FENDRTISFIPPDGAFDLMTYRLSTQVKPLIWVEAQIESHSRSRVEMLIKARSQFKERSTATNVE 314

  Fly   324 VKIPTPLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIEL----LETDTKKKWT 384
            :::|.|.:.|...:....|.|.|...::|:|||||...|.||..|.||..|    .|..|.::  
plant   315 IELPVPTDASNPTVRTSLGSASYAPEKDALVWKIKSFPGNKEYMLRAEFHLPSITAEEATPER-- 377

  Fly   385 RPPISMNFEVP-FAPSGFKVRYLKVFEPKLNYSDHDVVKWVRYIGRSGLYETR 436
            :.||.:.||:| |..||.:|||||:.|.    |.:..:.|||||..:|.||.|
plant   378 KAPIRVKFEIPYFTVSGIQVRYLKIIEK----SGYQALPWVRYITMAGEYELR 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2muNP_001163686.1 AP2_Mu_N 1..140 CDD:341440 48/136 (35%)
AP-2_Mu2_Cterm 166..436 CDD:271159 104/274 (38%)
HAP13NP_176277.1 AP1_Mu_N 6..145 CDD:341439 49/143 (34%)
AP-1_Mu1_Cterm 156..426 CDD:271158 110/286 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D725236at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.