DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2mu and stnB

DIOPT Version :9

Sequence 1:NP_001163686.1 Gene:AP-2mu / 42642 FlyBaseID:FBgn0263351 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_001036318.2 Gene:stnB / 4379834 FlyBaseID:FBgn0016975 Length:1262 Species:Drosophila melanogaster


Alignment Length:436 Identity:91/436 - (20%)
Similarity:164/436 - (37%) Gaps:95/436 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FHIKRANIWLAAVTKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGY 120
            |:.:|..:....|||               .|.:.:...|.::..|..::..:.|...::...|.
  Fly   809 FYKERPGVRPGQVTK---------------AERITNKLTKFAQYAIAGDYEGVKEFGSDLKKLGL 858

  Fly   121 PQNTDSGTLKTFITQQGIKSATKEEQMQITSQVTGQI----GWRREGIKYRRNELFLDVLEYVNL 181
            |......:.:.|    .|.|...|:..|.:..:...:    ..|...:.|:..|:.:..::.:.:
  Fly   859 PVEHAPQSSQLF----KIGSMNYEDMKQFSVCIEEALFKIPALRERALTYKMEEVQVTAVDEITV 919

  Fly   182 LMSPQGQVLSAHVAGKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGNSEAETSRSGKPV---- 242
            ....:|::|......::...::|:|||..:.|:||   |..:|:.:.|..:.      .||    
  Fly   920 EQDFEGKILKQIARVRLFFLAFLTGMPTIELGVND---MWRQGKEVVGRHDI------IPVATEE 975

  Fly   243 -VVIDDCQFHQCVKLSKFETEHSISFIPPDGEF-ELMRYRT--TKDISLPFRVIPLVREVGRTKM 303
             :.::..:||..|...::|...:|.|.|||..: ||:|:|.  .|:..||.: :.....|...|:
  Fly   976 WIRLEAVEFHSVVNQKEYERTRTIKFQPPDANYIELLRFRVRPPKNRELPLQ-LKATWCVSGNKV 1039

  Fly   304 EVKV-VLKSNFKPSLLGQ----KIEVKIPTP---------------------------------- 329
            |::. :|...|....|||    .:.|:.|.|                                  
  Fly  1040 ELRADILVPGFTSRKLGQIPCEDVSVRFPIPECWIYLFRVEKHFRYGSVKSAHRRTGKIKGIERI 1104

  Fly   330 ---LNTSGVQLI-CLKGKAKYKASENAIVWKIKRM----AGMKET-QLSAEIELLETDTKKKWTR 385
               ::|....|| ...|:|||:....||||:..|:    .|...| ||...:.|...|.......
  Fly  1105 LGAVDTLQESLIEVTSGQAKYEHHHRAIVWRCPRLPKEGQGAYTTHQLVCRMALTSYDQIPSELA 1169

  Fly   386 PPISMNFEVPFAPSGFKVRYLKVFEPKLNYSDHD--VVKWVRYIGR 429
            |...:.|.:|    ..:|.:..|....:..||.|  ..|:|||:.|
  Fly  1170 PYAFVEFTMP----ATQVSHTTVRSVSVQDSDGDEPPEKYVRYLAR 1211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2muNP_001163686.1 AP2_Mu_N 1..140 CDD:341440 13/83 (16%)
AP-2_Mu2_Cterm 166..436 CDD:271159 74/322 (23%)
stnBNP_001036318.2 Trypan_PARP 377..496 CDD:114603
AP_MHD_Cterm 897..1219 CDD:299401 75/329 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439809
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.