DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2mu and AP-1mu

DIOPT Version :9

Sequence 1:NP_001163686.1 Gene:AP-2mu / 42642 FlyBaseID:FBgn0263351 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_649906.1 Gene:AP-1mu / 41150 FlyBaseID:FBgn0024833 Length:426 Species:Drosophila melanogaster


Alignment Length:441 Identity:187/441 - (42%)
Similarity:266/441 - (60%) Gaps:31/441 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFVYNHKGEVLISRVYR-DDIGRNAVDAFRVNVIHARQQ-VRSPVTNIARTSFFHIKRANIWLAA 67
            :||.:.||:|||||.|| |:|....:|.|...::...:: :.:|:...|.|:|.:||..|:::.:
  Fly     6 IFVLDVKGKVLISRNYRGDNIDMAVIDKFMPLLMEREEEGLITPILQTAETTFAYIKTNNLYIVS 70

  Fly    68 VT--KQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGYPQNTDSGTLK 130
            .|  .:|||.|:||.||.||.:|...||.::.||:|::|||:|||||||:|||||||.|||..|:
  Fly    71 TTPRNKNVNIALVFVFLHKIAQVFVEYFKELEEESIRDNFVIIYELLDELLDFGYPQTTDSKILQ 135

  Fly   131 TFITQQGIKSATKEEQMQITSQVTGQIGWRREGIKYRRNELFLDVLEYVNLLMSPQGQVLSAHVA 195
            .:|||:|.|   .|.|.:|...||..:.||.||||||:||:||||:|.||||.:..|.||.:.:.
  Fly   136 EYITQEGHK---L
ELQPRIPVAVTNAVSWRSEGIKYRKNEVFLDVIESVNLLANANGNVLRSEIV 197

  Fly   196 GKVVMKSYLSGMPECKFGINDKIVMESKGRGLSGNSEAETSRSGKPVVVIDDCQFHQCVKLSKFE 260
            |.:.|:.|||||||.:.|:|||::.||.|||.|.:.|            ::|.:|||||:||:||
  Fly   198 GAIKMRVYLSGMPELRLGLNDKVLFESTGRGKSKSVE------------LEDVKFHQCVRLSRFE 250

  Fly   261 TEHSISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRTKMEVKVVLKSNFKPSLLGQKIEVK 325
            .:.:|||||||||||||.||....:.....:..::.....:::|..:..||.||.......:|:.
  Fly   251 NDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIERHAHSRVEYMIKAKSQFKRRSTANNVEIV 315

  Fly   326 IPTPLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIEL----LETDTKKKWTRP 386
            ||.|.:....:.....|..||...:|||:|.||...|.||..:.|...|    .|.:|:.|   |
  Fly   316 IPVPADADSPKFKTTIGSCKYAPEQNAIIWTIKSFPGGKEYLMRAHFGLPSVESEDNTEGK---P 377

  Fly   387 PISMNFEVP-FAPSGFKVRYLKVFEPKLNYSDHDVVKWVRYIGRSGLYETR 436
            ||.:.||:| |..||.:|||||:.|.    |.:..:.|||||.::|.|:.|
  Fly   378 PIQVRFEIPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLR 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2muNP_001163686.1 AP2_Mu_N 1..140 CDD:341440 64/138 (46%)
AP-2_Mu2_Cterm 166..436 CDD:271159 110/274 (40%)
AP-1muNP_649906.1 AP1_Mu_N 4..145 CDD:341439 65/141 (46%)
AP-1_Mu1A_Cterm 155..425 CDD:271166 119/289 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D47352at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10529
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.