DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2mu and ap1m1

DIOPT Version :9

Sequence 1:NP_001163686.1 Gene:AP-2mu / 42642 FlyBaseID:FBgn0263351 Length:437 Species:Drosophila melanogaster
Sequence 2:NP_989033.1 Gene:ap1m1 / 394630 XenbaseID:XB-GENE-1006856 Length:423 Species:Xenopus tropicalis


Alignment Length:434 Identity:175/434 - (40%)
Similarity:259/434 - (59%) Gaps:20/434 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQ-VRSPVTNIARTSFFHIKRANIWLAAV 68
            ::|.:.||:|||.|.||.|:..:.|:.|...::...:: ..||:.......|..||..|::|.|.
 Frog     6 VYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGALSPILAHGGVRFMWIKHNNLYLVAT 70

  Fly    69 TKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGYPQNTDSGTLKTFI 133
            :|:|...::||.||.|:::|...||.::.||:|::|||:|||||||::||||||.|||..|:.:|
 Frog    71 SKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFGYPQTTDSKILQEYI 135

  Fly   134 TQQGIKSATKEEQMQITSQVTGQIGWRREGIKYRRNELFLDVLEYVNLLMSPQGQVLSAHVAGKV 198
            ||:|.|..|...:...|  ||..:.||.||||||:||:||||:|.||||:|..|.||.:.:.|.:
 Frog   136 TQEGHKL
ETGAPRPPAT--VTNAVSWRSEGIKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSI 198

  Fly   199 VMKSYLSGMPECKFGINDKIVMESKGRGLSGNSEAETSRSGKPVVVIDDCQFHQCVKLSKFETEH 263
            .|:.:||||||.:.|:|||::.|:.|||.|.:.|            ::|.:|||||:||:||.:.
 Frog   199 KMRVFLSGMPELRLGLNDKVLFENTGRGKSKSVE------------LEDVKFHQCVRLSRFENDR 251

  Fly   264 SISFIPPDGEFELMRYRTTKDISLPFRVIPLVREVGRTKMEVKVVLKSNFKPSLLGQKIEVKIPT 328
            :|||||||||||||.||....:.....:..::.:...:::|..:..||.||.......:|:.||.
 Frog   252 TISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPV 316

  Fly   329 PLNTSGVQLICLKGKAKYKASENAIVWKIKRMAGMKETQLSAEIELLETDTKKKWTRPPISMNFE 393
            |.:....:.....|..|:....:.|||.||...|.||..:.|...|...:.:.|..:||||:.||
 Frog   317 PNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFE 381

  Fly   394 VP-FAPSGFKVRYLKVFEPKLNYSDHDVVKWVRYIGRSGLYETR 436
            :| |..||.:|||||:.|.    |.:..:.|||||.::|.|:.|
 Frog   382 IPYFTTSGIQVRYLKIIEK----SGYQALPWVRYITQNGDYQLR 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2muNP_001163686.1 AP2_Mu_N 1..140 CDD:341440 57/135 (42%)
AP-2_Mu2_Cterm 166..436 CDD:271159 106/270 (39%)
ap1m1NP_989033.1 AP1_Mu_N 4..142 CDD:341439 57/135 (42%)
AP-1_Mu1A_Cterm 153..422 CDD:271166 115/285 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D725236at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.