DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AP-2mu and LOC110438225

DIOPT Version :9

Sequence 1:NP_001163686.1 Gene:AP-2mu / 42642 FlyBaseID:FBgn0263351 Length:437 Species:Drosophila melanogaster
Sequence 2:XP_021324702.1 Gene:LOC110438225 / 110438225 -ID:- Length:133 Species:Danio rerio


Alignment Length:127 Identity:54/127 - (42%)
Similarity:85/127 - (66%) Gaps:1/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFVYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQ-VRSPVTNIARTSFFHIKRANIWLAAV 68
            :||.:.||:|||.|.|:.|:..:.:|.|...::...:. :.|||.:.....|..||..|::|.|.
Zfish     6 VFVLDLKGKVLICRNYKGDVDMSEIDHFFTLLMQQEEDGLISPVMSHGNVHFLWIKHNNLYLVAT 70

  Fly    69 TKQNVNAAMVFEFLLKIIEVMQSYFGKISEENIKNNFVLIYELLDEILDFGYPQNTDSGTLK 130
            |.:|.||::|:.||.|::||...||.::.||:|::|||::||||||::|||:||.|||..|:
Zfish    71 TNKNSNASLVYAFLYKLVEVFTEYFKELEEESIQDNFVVVYELLDELMDFGFPQTTDSKILQ 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AP-2muNP_001163686.1 AP2_Mu_N 1..140 CDD:341440 54/127 (43%)
AP-2_Mu2_Cterm 166..436 CDD:271159
LOC110438225XP_021324702.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D725236at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.