DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34376 and ZBTB9

DIOPT Version :9

Sequence 1:NP_732741.1 Gene:CG34376 / 42638 FlyBaseID:FBgn0085405 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_689948.1 Gene:ZBTB9 / 221504 HGNCID:28323 Length:473 Species:Homo sapiens


Alignment Length:341 Identity:80/341 - (23%)
Similarity:116/341 - (34%) Gaps:95/341 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GDLVDVTLACDGKLLHAHKIVLAICSPYFQEIFTTNPCKHPIIILKD---------VSFNIMMEL 82
            |...||:|...|:.|.|||.|||..||||          |..::|.|         :..:....|
Human    45 GKFCDVSLLVQGRELRAHKAVLAAASPYF----------HDKLLLGDAPRLTLPSVIEADAFEGL 99

  Fly    83 LEFMYQGVVNVKHTELQSFMKIGQLLQ-----------IKGLAT-----------------NSNS 119
            |:.:|.|.:.:....|.:.:.:...||           ::.|.|                 ::.|
Human   100 LQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARGGNSYHALLSTTS 164

  Fly   120 SPGSSVSEKSSSQPPAEESSNTNSTNHHNSSTNS------------------NNNSKSETDHNES 166
            |.|......|..|.|.:.|::|.|.    :||.|                  ....:.|.|.:|.
Human   165 STGGWCIRSSPFQTPVQSSASTESP----ASTESPVGGEGSELGEVLQIQVEEEEEEEEDDDDED 225

  Fly   167 KGQSN-SRTTSP----GGASRASNDASHLYTSNKRPMPSDFGSDS-----------LSIYSGKQL 215
            :|.:. |:|..|    |...|.........|:..|.:|.  |..:           ..|:..||.
Human   226 QGSATLSQTPQPQRVSGVFPRPHGPHPLPMTATPRKLPE--GESAPLELPAPPALPPKIFYIKQE 288

  Fly   216 RRSLKDH--GSGGSEGGGGDHADTAAGLDNSMNSE-EFFLPPIPQITMGEQRYDLGGLKRESDGH 277
            ....|:.  |||...||..:.....:|.|...|.| .|.||..|..|.|.     ||...:....
Human   289 PFEPKEEISGSGTQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGG-----GGPSWKPVDL 348

  Fly   278 HHGPLSAGGGNSGSVG 293
            |...:.:|||..|..|
Human   349 HGNEILSGGGGPGGAG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34376NP_732741.1 BTB 20..113 CDD:279045 26/105 (25%)
BTB 31..115 CDD:197585 26/103 (25%)
FLYWCH 390..443 CDD:282369
ZBTB9NP_689948.1 BTB 38..140 CDD:306997 26/104 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..279 21/107 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..376 24/77 (31%)
C2H2 Zn finger 388..405 CDD:275368
C2H2 Zn finger 413..433 CDD:275368
zf-C2H2 413..433 CDD:306579
C2H2 Zn finger 440..457 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.