DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34376 and NACC2

DIOPT Version :9

Sequence 1:NP_732741.1 Gene:CG34376 / 42638 FlyBaseID:FBgn0085405 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_653254.1 Gene:NACC2 / 138151 HGNCID:23846 Length:587 Species:Homo sapiens


Alignment Length:438 Identity:87/438 - (19%)
Similarity:139/438 - (31%) Gaps:140/438 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DVTLACDGKLLHAHKIVLAICSPYFQEIFTTNPCKHPIIILKDVSFNIMMELLEFMYQGVVNVKH 95
            ||::...|:...||:.|||..|.||:::|:.| .|....:...|......::|.|.|.|.:.:..
Human    31 DVSIVVKGQAFKAHRAVLAASSLYFRDLFSGN-SKSAFELPGSVPPACFQQILSFCYTGRLTMTA 94

  Fly    96 TELQSFMKIGQLLQIKGLATNSNSSPGSSVSEKSSSQPPAEESSNTNSTNHHNSSTNSNNNSKSE 160
            :|....|.....|||:.:...     |:.:..|.||.             |.:|.|....::.||
Human    95 SEQLVVMYTAGFLQIQHIVER-----GTDLMFKVSSP-------------HCDSQTAVIEDAGSE 141

  Fly   161 TDHNESKGQSNSRTTSPGGASRASNDASHLYTSNKRPMPSDFGSDSLSIYSGKQLRRSLKDHGSG 225
            .       ||......|..|:     |:....|...|:|                          
Human   142 P-------QSPCNQLQPAAAA-----AAPYVVSPSVPIP-------------------------- 168

  Fly   226 GSEGGGGDHADTAAGLDNSMNSEEFFLPPIPQITMGEQRYDLGGL--KRESDGHHHGPLSAGGGN 288
                           |...:..|...|||...           ||  ||        ||..|..:
Human   169 ---------------LLTRVKHEAMELPPAGP-----------GLAPKR--------PLETGPRD 199

  Fly   289 SGSVGSLTSSASPSAPIRNPFAPNF-----------MDSFNYYKGGNSSGPSGSSNNSVGPGGVN 342
            ..:|.:..:.|:.:||::.|....:           :....|.:|..:|..:.|...:..|...:
Human   200 GVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYH 264

  Fly   343 NNGSVGLGSGAEYPNELY---MPNDYSKSFANHMDIPSSGSNMVM--LSTTSLLHGNCVFNRNNT 402
            |...       |..:|.|   :...|.:     |.|.:|||..|.  .....|...:||..|.:.
Human   265 NEED-------EEDDEAYDTMVEEQYGQ-----MYIKASGSYAVQEKPEPVPLESRSCVLIRRDL 317

  Fly   403 VATQQGMKTYWLCKSYRISMCRARCITHLG---------RIISATGVH 441
            ||....:          ||....||...|.         .:::.:||:
Human   318 VALPASL----------ISQIGYRCHPKLYSEGDPGEKLELVAGSGVY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34376NP_732741.1 BTB 20..113 CDD:279045 24/81 (30%)
BTB 31..115 CDD:197585 24/83 (29%)
FLYWCH 390..443 CDD:282369 13/61 (21%)
NACC2NP_653254.1 BTB 20..120 CDD:279045 25/94 (27%)
BTB 31..114 CDD:197585 24/83 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..272 7/38 (18%)
BEN 373..450 CDD:214981
TIM_phosphate_binding 496..>581 CDD:304361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5230
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.