DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34376 and btbd18

DIOPT Version :9

Sequence 1:NP_732741.1 Gene:CG34376 / 42638 FlyBaseID:FBgn0085405 Length:681 Species:Drosophila melanogaster
Sequence 2:XP_017951392.1 Gene:btbd18 / 100498010 -ID:- Length:602 Species:Xenopus tropicalis


Alignment Length:313 Identity:57/313 - (18%)
Similarity:92/313 - (29%) Gaps:95/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QNLYDRGDLVDVTL-ACDGKLLHAHKIVLAICSPYFQEIFTT--------------NPCKHPIII 70
            |...:.|...|||| ..:|:.:..|..:||.||||..::..:              ..|...|:.
 Frog    23 QRQQNTGFFCDVTLQGGEGEGVSVHACLLAACSPYLAKLLASVTEVSQLDTDSAIQTDCTGHILT 87

  Fly    71 LKDVSFNIMMELLEFMYQGVVNVKHTELQSFMKIGQLLQI------------------------- 110
            :..:....::.|:.:||...:.|....:...::..:.|||                         
 Frog    88 VPGIPSCYLLPLVHYMYTSELEVTPENVHGVLEAARRLQIPELEGLRLEGGRLVRPELARKLNRD 152

  Fly   111 ----------------KGLATNSNSSPGSSVSEKSSSQPPAEESSNTNSTNHHNSSTNSNNNSKS 159
                            |.:.|....:.|.:|..:...|.|......||..:...:.|.|....|.
 Frog   153 CFGSVISQYATESGNGKQIFTKEEITSGRNVPVRMHEQGPCILEKRTNKEHTFPADTGSLLRGKM 217

  Fly   160 ETDHN-----------------ESKGQSNSRT--TSPGGASRASNDASHLYTSNKRPMPSDFGSD 205
            |...:                 |..|.|..:|  .|......|..|:.  .|.|...:..|....
 Frog   218 EASSSLQGNIENPLLEITKNPTEKSGPSTVQTCFQSRENYECAFQDSG--TTQNVSAINQDIEMT 280

  Fly   206 SLS------IYSGKQLRRSL-KDHGSGGSEGGGGDHADTAAGLDNSMNSEEFF 251
            .||      :.:..|.|..| .:||           |||.......|..::.|
 Frog   281 KLSSEIPLIVLNPDQKRHILVSEHG-----------ADTVPSRKTDMQDKKLF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34376NP_732741.1 BTB 20..113 CDD:279045 24/147 (16%)
BTB 31..115 CDD:197585 22/139 (16%)
FLYWCH 390..443 CDD:282369
btbd18XP_017951392.1 BTB_POZ_BTBD18 17..148 CDD:349602 23/124 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000141
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.