DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and SEC14

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:57/265 - (21%)
Similarity:96/265 - (36%) Gaps:67/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DGDPERVLAQVQDLSDWLVANPQINGCNTFENLH-----FFLRTSKFDVERAKKKLKTFYQMRAE 75
            |...|:.||:::.|         :......|.|.     .|||..||||:.||            
Yeast    30 DSAQEKALAELRKL---------LEDAGFIERLDDSTLLRFLRARKFDVQLAK------------ 73

  Fly    76 RTEWFDNRDPQLPE------IQDL-----LKLGVFLP---IGPDAEQRMVVVIRTAAHDPKLHSQ 126
              |.|:|.:....:      :||.     ..:..|.|   ...|.:.|.|......|  ..||..
Yeast    74 --EMFENCEKWRKDYGTDTILQDFHYDEKPLIAKFYPQYYHKTDKDGRPVYFEELGA--VNLHEM 134

  Fly   127 NNVFKTSKMILDLLLKLDP------ETCARG-------MVAILDMQGVQLGHALQMNPKLIKRSV 178
            |.|....:|:.:|:.:.:.      ..|:|.       ...|:|::|:.:..|..:...:.:.|.
Yeast   135 NKVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYSVMSYVREASY 199

  Fly   179 ESWTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREGTS--------VSCDQLPK 235
            .|...||.:.......|||...:.....|:.|:.|...|::|:.  |:|        :..:.||.
Yeast   200 ISQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFIL--GSSYQKELLKQIPAENLPV 262

  Fly   236 ELGGQ 240
            :.||:
Yeast   263 KFGGK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 37/187 (20%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 17/67 (25%)
SEC14 99..269 CDD:214706 36/173 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.