DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and AT1G05370

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_172029.2 Gene:AT1G05370 / 837038 AraportID:AT1G05370 Length:417 Species:Arabidopsis thaliana


Alignment Length:193 Identity:43/193 - (22%)
Similarity:75/193 - (38%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWSRSSSSKRQVATTDGDPERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKK 65
            |..:.......|..:|...|.||..::..|...:...:.  ||. ..:..|||....:|::|.|:
plant     1 MGKKEQKDHHSVVESDDKVEAVLHLLRKHSPLTLKQEKF--CNR-ACVGRFLRIKGDNVKKAAKQ 62

  Fly    66 LKTFYQMRAE---RTEWFDNRDPQLPEIQDLLKLGVFLPIGPDAEQRMVVVIRTAAHDPKLHSQN 127
            |::....|:.   .:...|....:|.|       |:....|.|.|.|.|:|.|......|||:|.
plant    63 LRSCLSWRSSLGIESLIADEFTAELAE-------GLAYVAGLDDECRPVLVFRIKQDYQKLHTQK 120

  Fly   128 NVFKTSKMILDLLLKLDPETCARGM---VAILDMQGVQLGHALQMNPKLIKRSVESWTAYPCQ 187
            .:.:.....|::.:    .|.:|.:   |.:.|....:...|. ||..:....:.: ..|||:
plant   121 QLTRLVVFTLEVAI----STMSRNVEQFVILFDASFFKSASAF-MNILVTTLKIVA-EYYPCR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 25/104 (24%)
AT1G05370NP_172029.2 SEC14 89..219 CDD:238099 24/102 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.