DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and AT4G36640

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001329225.1 Gene:AT4G36640 / 829816 AraportID:AT4G36640 Length:294 Species:Arabidopsis thaliana


Alignment Length:311 Identity:63/311 - (20%)
Similarity:103/311 - (33%) Gaps:102/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KRQVATTDGDPERVLAQVQDLSDWL--VANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQ 71
            :|.....|.|..:...:|::|...:  ::...:..|:. .:|..||....:|||:|||.::    
plant     4 RRNAHQLDNDDSQQDNKVRELKSAIGPLSGHSLVFCSD-ASLRRFLDARNWDVEKAKKMIQ---- 63

  Fly    72 MRAERTEWFDNRDPQLPEIQDLLKLGVFLPIGP-------DAEQRMVVVIRTAAHD--------- 120
               |..:|.....||......:...|   ..|.       |.:.|:|:::|.|..:         
plant    64 ---ETLKWRSTYKPQEIRWNQVAHEG---ETGKASRASFHDRQGRVVLIMRPAMQNSTSQEGNIR 122

  Fly   121 -------------PKLHSQ--------------NNVFKTSKMILDLLLKLDPETCARGMVAILDM 158
                         ||...|              |...||::.|:.:|....||            
plant   123 HLVYLLENAIINLPKGQKQMSWLIDFTGWSMAVNPPMKTTREIIHILQNYYPE------------ 175

  Fly   159 QGVQLGHALQMNPKLIKRSVESWTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRR 223
               :||.|...||..:.::|.....|...|:..|      .|.|      ::...|....|..  
plant   176 ---RLGIAFLYNPPRLFQAVYRAAKYFLDPRTAE------KVKF------VYPKDKASDELMT-- 223

  Fly   224 EGTSVSCDQLPKELGGQG-LSYMELSVKWKQLVEENADFYVEQDKYKSKLK 273
              |....:.||||.||:. |.|            ::.||  .:..|:..||
plant   224 --THFDVENLPKEFGGEATLEY------------DHEDF--SRQMYEDDLK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 36/195 (18%)
AT4G36640NP_001329225.1 CRAL_TRIO_N 20..65 CDD:215024 12/52 (23%)
SEC14 85..238 CDD:214706 36/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.