DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and TTPAL

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001034288.1 Gene:TTPAL / 79183 HGNCID:16114 Length:342 Species:Homo sapiens


Alignment Length:261 Identity:74/261 - (28%)
Similarity:117/261 - (44%) Gaps:25/261 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PERVLAQVQDLSDWLVANPQINGCNTFEN--LHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFD 81
            ||..|..||.|.| :|.....|...:.::  |..|||..|||.:||.:.|..::..|....|.|:
Human    51 PEWRLRDVQALRD-MVRKEYPNLSTSLDDAFLLRFLRARKFDYDRALQLLVNYHSCRRSWPEVFN 114

  Fly    82 NRDPQLPEIQDLLKLGVFLPIGPDAEQR--MVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLD 144
            |..|.  .::|:|..| ||.:.|..:.|  .||.||.....|..:......:...:.|:.|::.:
Human   115 NLKPS--ALKDVLASG-FLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSE 176

  Fly   145 PETCARGMVAILDMQGVQLGHALQMNPKLIKRSVE-SWTAYPCQPKLLEFTNAPRHVNFFLNTFR 208
             ||...|:|.:.|.:||.|..|....|.:.|:.:. ....:|.:.|.:...|.||   .|...|.
Human   177 -ETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPR---IFKGIFA 237

  Fly   209 I---FMTPKIRSRLFVRREG-----TSVSCDQLPKELGGQGLSYMEL-SVKWKQLVEENADFYVE 264
            |   |:..||.:|.|:....     |::....||||.||   :..|| :..|..::..:.|.:|:
Human   238 IIKPFLKEKIANRFFLHGSDLNSLHTNLPRSILPKEYGG---TAGELDTATWNAVLLASEDDFVK 299

  Fly   265 Q 265
            :
Human   300 E 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 44/163 (27%)
TTPALNP_001034288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
CRAL_TRIO_N 56..102 CDD:215024 16/46 (35%)
SEC14 121..277 CDD:238099 45/163 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.