DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and RLBP1

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:201 Identity:44/201 - (21%)
Similarity:89/201 - (44%) Gaps:20/201 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGVFLPIGP------DAEQR 109
            |:|..||:|.||.:.|:.:...|.:..|.||:..|:  .::..::.|.     |      |...|
Human   108 FIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPE--AVRCTIEAGY-----PGVLSSRDKYGR 165

  Fly   110 MVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLI 174
            :|::........:..:.:.:.:....||:.||: :.||...|...|.:.:|..:..|..:....:
Human   166 VVMLFNIENWQSQEITFDEILQAYCFILEKLLE-NEETQINGFCIIENFKGFTMQQAASLRTSDL 229

  Fly   175 KRSVES-WTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREGTS-----VSCDQL 233
            ::.|:. ..::|.:.|.:.|.:.|.:.....|..:.|:..|:..|:||..:..|     :..:.|
Human   230 RKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENIL 294

  Fly   234 PKELGG 239
            |.:.||
Human   295 PSDFGG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 31/165 (19%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.