DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and sec14l8

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:261 Identity:59/261 - (22%)
Similarity:102/261 - (39%) Gaps:74/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAQ----VQDLSDWLVANPQINGCNTFENLHF---FLRTSKFDVERAKKKLKTFYQMRAE----- 75
            |||    |||:.      ||   |.: ::.||   :||...|::::::..|:...:.|..     
Zfish    16 LAQFREKVQDVL------PQ---CPS-QSDHFLLRWLRARNFNLQKSEAMLRKHIEFRKHMKVDT 70

  Fly    76 -RTEWFDNRDPQLPEIQDLLKLGVFLPIGPDAEQRMVVVIRTAAHDPK--LH--SQNNVFKTSKM 135
             .|||      |:||:.|....|..  .|.|.|...|........|||  :|  |:.::.|:...
Zfish    71 ITTEW------QVPEVIDKYLSGGM--CGHDREGSPVWYDVIGPLDPKGLMHSASKQDLIKSKVR 127

  Fly   136 ILDLLLKLDPETCAR----------GMVAILDMQGVQLGHALQMNPKLIKRSVESW--------T 182
            ..::|.|    .|.|          .:..:.|.:|:.:.|       |.|.::|::        .
Zfish   128 DCEILQK----DCDRQSERLGRNIESITMVYDCEGLGMKH-------LYKPAIETYGEVLTMFED 181

  Fly   183 AYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREGTS--------VSCDQLPKELGG 239
            .||...|.|....||:......|..:.|::...|.::.|.  |::        :..::||...||
Zfish   182 NYPEGLKRLFVIKAPKLFPVAYNLVKHFLSEDTRRKVIVL--GSNWQEVLQKYIDPEELPAYYGG 244

  Fly   240 Q 240
            :
Zfish   245 K 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 38/182 (21%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 15/52 (29%)
SEC14 78..246 CDD:214706 39/183 (21%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.