DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and sec14l5

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031749906.1 Gene:sec14l5 / 493292 XenbaseID:XB-GENE-953433 Length:793 Species:Xenopus tropicalis


Alignment Length:229 Identity:46/229 - (20%)
Similarity:84/229 - (36%) Gaps:50/229 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ENLHFFLRTSKFDVERAKKKLKTFYQMRAER------TEWFDNRDPQLPEIQDLLKLGVFLPIG- 103
            |::..|||...|::::|::.|......|.:.      :.|    ||  |::     |..:...| 
 Frog   278 EHILRFLRARDFNIDKAREILCQSLTWRKQHHVDYLLSTW----DP--PQV-----LHDYYAGGW 331

  Fly   104 --PDAEQRMVVVIRTAAHDPKLHSQNNVFKT--SKMILDLLLKLDPETCAR-------------G 151
              .|.:.|.:.|:|....|.|     .:.:.  .:.:|..:|.::.|...|             .
 Frog   332 HHHDRDGRPLYVLRLGQMDTK-----GLVRALGEESLLRHVLSINEEGLRRCEENTNIFGRPISS 391

  Fly   152 MVAILDMQGVQLGHALQMNPKLIKRSVESWTA-YPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKI 215
            ...::|::|:.:.|..:...|.:.|.:|...| ||.....|....|||...........|:....
 Frog   392 WTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENT 456

  Fly   216 RSRLFVRR----EGTSVSCDQLPKE-----LGGQ 240
            |.:..:..    :|.....|.:.||     |||:
 Frog   457 RKKFLIYAGNDYQGPGGLIDYIDKEVIPDFLGGE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 34/180 (19%)
sec14l5XP_031749906.1 PRELI 17..173 CDD:398400
CRAL_TRIO_N 256..301 CDD:215024 7/22 (32%)
CRAL_TRIO 326..490 CDD:395525 32/168 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.