DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and rlbp1

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001005455.1 Gene:rlbp1 / 448050 XenbaseID:XB-GENE-976303 Length:317 Species:Xenopus tropicalis


Alignment Length:196 Identity:48/196 - (24%)
Similarity:93/196 - (47%) Gaps:10/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGV-FLPIGPDAEQRMVVVI 114
            |:|..||||.||.:.||.:...|.:..|.|::..|:  .::..::.|. .:....|...|::::.
 Frog    99 FIRARKFDVSRAYELLKGYVNFRQQYPELFEDLTPE--AVRSTIEAGYPGILTSRDKNGRVILLF 161

  Fly   115 RTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVE 179
            ...:.|.:..:.:.:.:...:||:.||: :.||...|...|.:.:|..:..|..:.|..:|:.|:
 Frog   162 NIESWDYEEITFDEILRAYCIILESLLE-NEETQINGFCIIENFKGFTMQQASGIKPSELKKMVD 225

  Fly   180 S-WTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVR---REG--TSVSCDQLPKELG 238
            . ..::|.:.|.:.|.:.|.:.....|..:.|:..|:..|:||.   .||  ..:..|.||.:.|
 Frog   226 MLQDSFPARFKAVHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLEGFYKEIDADILPADFG 290

  Fly   239 G 239
            |
 Frog   291 G 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 34/160 (21%)
rlbp1NP_001005455.1 CRAL_TRIO_N 60..117 CDD:215024 10/17 (59%)
CRAL_TRIO 143..292 CDD:306996 34/150 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.