DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG10300

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:264 Identity:53/264 - (20%)
Similarity:110/264 - (41%) Gaps:26/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFDNR---DPQL 87
            :..:..|:..:|.:......:.:..|||..:|..|..|::...:|.:|:...|...:|   :..|
  Fly    31 IATIKTWITKSPHLKAPTDEQLILAFLRRCRFSQEETKRRFDNYYSLRSVFPEVLGSRQVDEALL 95

  Fly    88 PEIQDLLKLGVFLPIGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGM 152
            .::|..:.:....|:.|:..:  |::.:....|||..:....||...::|:||..........|:
  Fly    96 TQLQRGIHVIPMRPVSPEGPR--VIISQFRNIDPKKSNPREAFKLIFIMLELLALECDNAAISGL 158

  Fly   153 VAILDMQGVQLGHALQMNPKLIKRS---VESWTAYPCQPKLLEFT-----NAPRHVNFFLNTFRI 209
            :.::|.:.|.:...:|.:|.|:|::   |:.     |.|  |.|.     |..:......|....
  Fly   159 IWVVDARDVTMEQMMQYDPFLLKKAFALVDQ-----CIP--LRFVEIHMINMRKEGQTIFNFVTK 216

  Fly   210 FMTPKIRSRLFVRREGTSVSCDQLPK-----ELGGQGLSYMELSVKWKQLVEENADFYVEQDKYK 269
            |:..|:..:..|.::...: ...||:     |.||......|....|:|.:.::.|:..:..:|.
  Fly   217 FLPSKLPFKFVVHKKSEDL-YQHLPRDVMTIEYGGTNGYQAEAVDHWRQKLLDSKDYLAKDAQYG 280

  Fly   270 SKLK 273
            :..|
  Fly   281 TNEK 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 34/165 (21%)
CG10300NP_651174.2 SEC14 95..251 CDD:238099 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.