DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG2663

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_649535.2 Gene:CG2663 / 40649 FlyBaseID:FBgn0037323 Length:308 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:122/264 - (46%) Gaps:17/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DPERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFDN 82
            ||..:...::.:.:||...|.:........|..|||..||.:|:.||||..:|.||....|:|.|
  Fly    23 DPADIERDIKLIREWLETQPHLPKDMDDMRLTTFLRGCKFSLEKVKKKLDMYYTMRNAVPEFFSN 87

  Fly    83 RDPQLPEIQDLLKLGVFLP----IGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKL 143
            ||....|:..:|.. |..|    |.|:.  |.:..||....|.:.|...:..|.:.||.|:.|..
  Fly    88 RDINREELNIVLDY-VHCPTLPGITPNG--RRITFIRGIDCDFQPHHILDAMKVALMIGDVRLAE 149

  Fly   144 DPETCARGMVAILDMQGVQLGHALQMNPKLIKR---SVESWTAYPCQPKLLEFTNAPRHVNFFLN 205
            :....| |.:.|||.......|..:.:|.::|:   :|:.  |||.:.|.:...|....|:...|
  Fly   150 ESVGIA-GDIFILDASVASAAHFAKFSPTVVKKFLIAVQE--AYPVKVKEVHVINISPLVDTIFN 211

  Fly   206 TFRIFMTPKIRSRLFVRREGTS----VSCDQLPKELGGQGLSYMELSVKWKQLVEENADFYVEQD 266
            ..:.|:..|||||:....:..|    |..|.||.|.||:....:||:..|||.:.:|..::.:|:
  Fly   212 FVKPFVKEKIRSRITFHNDVESLYKVVPRDLLPNEYGGKAGGVVELNQWWKQKLVDNTQWFKDQE 276

  Fly   267 KYKS 270
            ..|:
  Fly   277 DKKA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 45/163 (28%)
CG2663NP_649535.2 CRAL_TRIO_N 28..74 CDD:215024 14/45 (31%)
SEC14 95..250 CDD:238099 44/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.