DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and rlbp1b

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_991253.1 Gene:rlbp1b / 402990 ZFINID:ZDB-GENE-040426-1870 Length:307 Species:Danio rerio


Alignment Length:206 Identity:47/206 - (22%)
Similarity:92/206 - (44%) Gaps:20/206 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGVFLPIGP------DAEQR 109
            |:|..|:||.||.:.:|.:.:.|.:..|.|:|..|:  .::..::.|.     |      |...|
Zfish    99 FIRARKYDVNRAYELMKGYVRFRRDYPELFENLTPE--AVRSTIEAGY-----PGILSSRDKYGR 156

  Fly   110 MVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLI 174
            :|::......|.:..:.:.:.:...:||:.||: :.||...|...|.:.:|..:..|..:.|..:
Zfish   157 VVLLFNIENWDYEEITFDEILRAYCVILEKLLE-NEETQINGFCIIENFKGFTMQQASGIKPTEL 220

  Fly   175 KRSVES-WTAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREG-----TSVSCDQL 233
            |:.|:. ..::|.:.|.:.|.:.|.:.....|..:..|..|:..|:||..:.     .....:.|
Zfish   221 KKMVDMLQDSFPARFKAVHFIHQPWYFTTTYNVVKPLMKSKLLERVFVHGDDLENYFKEFDAEIL 285

  Fly   234 PKELGGQGLSY 244
            |.:..|:|..|
Zfish   286 PSDFDGKGSKY 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 31/164 (19%)
rlbp1bNP_991253.1 CRAL_TRIO_N 60..117 CDD:215024 8/17 (47%)
CRAL_TRIO 143..292 CDD:279044 31/154 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.