DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG33965

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:236 Identity:67/236 - (28%)
Similarity:109/236 - (46%) Gaps:22/236 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWF-DN 82
            |.||.:.:..|.:||...|.:..|...:.|..|||.|||.:|:||:|:..||.::|...|.| |.
  Fly    28 PSRVESDIAALKEWLQKQPHLCACLEDQFLLSFLRGSKFSLEKAKQKIDRFYSLQAVIPEVFNDQ 92

  Fly    83 RDPQLPEIQDLLKLGVFLPIGPDAEQR--MVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDP 145
            |.....::.::::|||.|.|..|.|..  .|.:||..::|.......::.:...|..::::..|.
  Fly    93 RLVDNAQVLEIIRLGVILRIPLDEEDTGPAVTIIRAGSYDINKFKFQDIIRVGSMFGEIMMLEDD 157

  Fly   146 ETCARGMVAILDMQGVQLGHALQMNPKLI-KRSVESWTAYPCQPKLLEFTNAPRHVNFFLNTFRI 209
            .....|.:.|:||.||...:...:.|:|: |.|..:..|.|.:.|.:.|.|.|:.......:...
  Fly   158 NASVSGYLEIMDMSGVTGANLFALQPQLLSKFSAYADEAMPTRQKGIHFINVPKAFETGFKSLLG 222

  Fly   210 FMTPKIRSRLFVRREGTSVSCD-----------QLPKELGG 239
            :...||:.|:       |||.|           .||:|.||
  Fly   223 WFPGKIKERV-------SVSSDPEAIFERVPKHYLPEEYGG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 41/167 (25%)
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 16/44 (36%)
SEC14 101..256 CDD:238099 39/161 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.