DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG32407

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:247 Identity:42/247 - (17%)
Similarity:90/247 - (36%) Gaps:62/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEW--FDNRDP 85
            |.::.|...|:..               .|:...||||:...:|   :...|.|..:  :|..:.
  Fly    37 LKRITDSDLWITK---------------LLQVYDFDVEKCITRL---WDNLAWRKSFGVYDITEA 83

  Fly    86 QLPEIQDLLKLGVFLPIGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETCAR 150
            .|.  |:.|..|.......|.:.:.::::....|. |..:|.::.   ::::..:.:|..::...
  Fly    84 NLN--QEFLNDGSIYVHNKDRDGKPLLILTIKKHS-KSRNQEDLL---RILVFWIERLQRDSNLD 142

  Fly   151 GMVAILDMQGVQLGHALQMNPKLIKRSVESW-TAYPCQPKLLEFTNAPRHVNFFLNTFRIFMTPK 214
            .:...:||.|..|.: |.|.  .||..:..: |.||..|..:...:.|..::......:.|:.| 
  Fly   143 KITIFMDMTGAGLSN-LDMG--FIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPP- 203

  Fly   215 IRSRLFVRREGTSVSCDQLPKELGGQGLSYMELSVKWKQLVEENADFYVEQD 266
                                     :.|..::::.|      ::.|.||::|
  Fly   204 -------------------------EALKILKVTTK------KDIDQYVDKD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 24/153 (16%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 27/172 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.