DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Cralbp

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:123/282 - (43%) Gaps:38/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TDGDPERVL---------------AQVQDLSDWLVANPQING--C-NTFENLHFFLRTSKFDVER 61
            |.|.||.:|               ..::.|.:|:..|..:..  | :||  |..|||..||.|..
  Fly     8 TTGLPEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTF--LLRFLRAKKFSVPM 70

  Fly    62 AKKKLKTFYQMRAERTEWFDNRDPQL----PEIQDLLKLG-VFLPIGPDAEQRMVVVIRTAAHDP 121
            |::.|..:..:|  ||  |.:...||    |.:.||:..| :|.....|...|.||||.....:|
  Fly    71 AEQTLLKYLNIR--RT--FPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNP 131

  Fly   122 KLHSQNNVFKTSKMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVESW--TAY 184
            |:|:..:..|...:..:.|:: |.||...|:..:.|..||...|....||....| :..|  .:.
  Fly   132 KIHTSCDQAKAHFLTYECLME-DQETQITGLTHVGDFAGVTTAHVTNWNPTEFAR-IFKWGEQSL 194

  Fly   185 PCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFV--RREGTSVSCDQ--LPKELGGQGLSYM 245
            |.:.|.:...|.|..:.:.::..:..::.|:::||.:  ..:....|.||  ||.|:||: :...
  Fly   195 PMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGK-VPMR 258

  Fly   246 ELSVKWKQLVEENADFYVEQDK 267
            |:...|||.:....|..:..||
  Fly   259 EMIELWKQELATKRDLILGLDK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 43/163 (26%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 15/48 (31%)
SEC14 101..254 CDD:238099 41/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.