DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG13893

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:261 Identity:60/261 - (22%)
Similarity:106/261 - (40%) Gaps:61/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAERTEW-FDNRDPQLP--EIQDLLKLGVFLPIGPDAEQRMVV 112
            :||..|:::|.|:|.|:...:.||   .| .||.:...|  .:|:.|..|:   :|.|.|...|:
  Fly    39 WLRARKWNLEAAEKMLRASLKTRA---MWNVDNIEKWDPPKALQEYLPYGL---MGYDNEGSPVL 97

  Fly   113 VIRTAAHD--PKLHSQNNVFKTSK---MILDLLLKLDPETC------ARGMVAILDMQGVQL-GH 165
            |...|..|  ..:|.... |:..|   ::|:..:|:..:..      ||.:|...|||.|.| .:
  Fly    98 VCPFANFDMWGMMHCVTR-FEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQY 161

  Fly   166 ALQMNPKLIKRSVESWTA-YPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREGTSVS 229
            |.:...:.:..:|:.:.| :|...|:....|||:..:...|..:.|:.....|::.:.:.|....
  Fly   162 AWRPAAECVISTVKQYEANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRW 226

  Fly   230 CDQL---------PKELGGQGLSYMELSVKWKQLVEENAD----------------FYVEQDKYK 269
            .:||         ||..||             ::|:.|.|                .|::|...:
  Fly   227 QEQLFSHVNRKAFPKAWGG-------------EMVDRNGDPQCKALMVWGGKLPEELYIDQSSQQ 278

  Fly   270 S 270
            |
  Fly   279 S 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 41/176 (23%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 7/17 (41%)
SEC14 75..246 CDD:238099 41/187 (22%)
GOLD_2 303..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.