DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Sec14l3

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:220 Identity:56/220 - (25%)
Similarity:92/220 - (41%) Gaps:47/220 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FLRTSKFDVERAKKKLKTFYQMRAERTEWFDN-RDPQLPE-IQDLLKLGVFLPIGPDAEQRMVVV 113
            :||...||:::::..|:.:.:.|  :|...|: .|.|.|| ||..:..|:   .|.|.:...|..
Mouse    41 WLRARNFDLQKSEAMLRKYMEFR--KTMDIDHILDWQPPEVIQKYMPGGL---CGYDRDGCPVWY 100

  Fly   114 IRTAAHDPK--LHS--QNNVFKTSKMILDLLL-KLDPETCARG-----MVAILDMQGVQLGHALQ 168
            ......|||  |.|  :.::.||.....:.:| :.|.:|...|     :|.|.|.:|:.|.|   
Mouse   101 DIIGPLDPKGLLFSVTKQDLLKTKMRDCERILHECDLQTERLGRKIETIVMIFDCEGLGLKH--- 162

  Fly   169 MNPKLIKRSVESWTAYPCQPKLLEFTNAPRHVNFFL------------NTFRIFMTPKIRSRLFV 221
                ..|..||.:..:   ..||| .|.|..:.|.|            |..:.|::...|.::.|
Mouse   163 ----FWKPLVEVYQEF---FGLLE-ENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVV 219

  Fly   222 R-----REG--TSVSCDQLPKELGG 239
            .     :||  ..:|.::||...||
Mouse   220 LGSNSWKEGLLKLISPEELPAHFGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 46/183 (25%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 5/17 (29%)
SEC14 76..246 CDD:214706 46/183 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.