DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Sec14l1

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:222 Identity:42/222 - (18%)
Similarity:79/222 - (35%) Gaps:47/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEW---------FDNRDPQLPEI-QDLLKLGVFL 100
            |::..|||...|::::|:       ::..:...|         .|...|  |:: ||....|.. 
  Rat   279 EHILRFLRARDFNIDKAR-------EIMCQSLTWRKQHQVDYILDTWTP--PQVLQDYYAGGWH- 333

  Fly   101 PIGPDAEQRMVVVIRTAAHDPKLHSQNNVFKT--SKMILDLLLKLDPETCAR------------- 150
              ..|.:.|.:.|:|....|.|     .:.:.  .:.:|..:|.::.|...|             
  Rat   334 --HHDKDGRPLYVLRLGQMDTK-----GLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPIS 391

  Fly   151 GMVAILDMQGVQLGHALQMNPKLIKRSVESWTA-YPCQPKLLEFTNAPRHVNFFLNTFRIFMTPK 214
            ....::|::|:.:.|..:...|.:.|.:|...| ||.....|....|||...........|:...
  Rat   392 SWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDN 456

  Fly   215 IRSRLFVRR----EGTSVSCDQLPKEL 237
            .|.:..:..    :|.....|.:.||:
  Rat   457 TRRKFLIYAGNDYQGPGGLLDYIDKEI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 33/172 (19%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 6/29 (21%)
CRAL_TRIO 327..491 CDD:279044 30/165 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.