DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG12926

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:267 Identity:75/267 - (28%)
Similarity:123/267 - (46%) Gaps:18/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PERVLAQVQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFDNR 83
            |:|:...::.|..|:...|.:......:.|..|||..|:.:|:.|.||..||.||....|.:.||
  Fly    28 PDRIDEDIETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRGAVPELYKNR 92

  Fly    84 ---DPQLPEIQDLLKLGVFL----PIGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLL 141
               :.||    .:|..|..|    |:..|..:  :.:.|...:|.|.:|...|.:.:.|:.::.:
  Fly    93 IVGEKQL----SILDTGCLLRLPQPLQADGPR--IHISRYGQYDSKKYSIAEVVQVNTMLGEIQI 151

  Fly   142 KLDPETCARGMVAILDMQGVQLGHALQMNPKLIKR-SVESWTAYPCQPKLLEFTNAPRHVNFFLN 205
            :.|......|.|.|:||:||..||..|.:..|:|: :|....|||.:||...|.|||.....|::
  Fly   152 REDDNAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRPKGFHFVNAPSSAEKFMS 216

  Fly   206 TFRIFMTPKIRSRLFVRREGTS----VSCDQLPKELGGQGLSYMELSVKWKQLVEENADFYVEQD 266
            ..:..|:.|||.|..:..:..|    |..:.||.|.||...:..::...|:..:.....|:.|:.
  Fly   217 IAKSLMSEKIRKRFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDVVSTWRTKLLAYKPFFEEEA 281

  Fly   267 KYKSKLK 273
            .|.:..|
  Fly   282 SYGTNEK 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 47/161 (29%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 12/44 (27%)
SEC14 117..254 CDD:238099 41/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.