DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and Ku80

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:150 Identity:34/150 - (22%)
Similarity:50/150 - (33%) Gaps:60/150 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSSSSKRQV-ATTDG----DP----ERVLAQVQDLSD---------WLVANPQI----------- 39
            :|..::::: ..:||    ||    .||||.|..:|:         .|.|:.::           
  Fly   543 KSEPAEKEIPLPSDGVGLIDPISDFRRVLASVHTISNATERDARFQALAADTRVVIITLLQRRKQ 607

  Fly    40 -------------NGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTE-WFDNR-DPQL-- 87
                         ..|..|..   ||...|| .|..||     ..:...|:| |.|.. |.||  
  Fly   608 NIGQLGELITLYRQSCIDFNT---FLEYDKF-AEELKK-----IALAKNRSEFWQDVMVDKQLGP 663

  Fly    88 -----PEIQDLLKLGVFLPI 102
                 |.:.|.|.|..:..|
  Fly   664 LVLGEPTLDDELALKAYYTI 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 5/22 (23%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445
Ku_PK_bind 562..663 CDD:285938 26/109 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.