DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG5973

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:297 Identity:67/297 - (22%)
Similarity:125/297 - (42%) Gaps:47/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WS--RSSSSKRQVATTDGDPERVLAQVQDLSDWLVANPQ-INGCNTFENLHFFLRTSKFDVERAK 63
            |:  ::....|:|   .|..|:.:.::::    |:.|.: :|.....|.:..|||.:.:..|.|.
  Fly    34 WALKKAQDELREV---PGVKEQAIKELRE----LIQNEKYLNLPLDDEYMMMFLRPTHYYPESAL 91

  Fly    64 KKLKTFYQMRAERTEWFDNRDPQLPEIQDLLKLGVFLPIGPDAEQ---RMVVVIRTAAHDPKLHS 125
            |:||.||.|:.:.....:|..|.  :::::.:..: |.:.|..:|   |::|:.......|....
  Fly    92 KRLKNFYHMKLKYGAACENIIPS--KLRNVFEANI-LNLLPQRDQHGRRLLVLEAGKKWKPSQVP 153

  Fly   126 QNNVFKTSKM-ILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVESWTAYPC-QP 188
            ..::|:..:: :|..:::...:.|  |.|.|:||:|:.|.|..|..|......::......| :.
  Fly   154 LVDLFRGIQLTVLGSMVEPYSQIC--GSVVIIDMEGLPLSHITQFTPSFAAMLLDYIQECICMRL 216

  Fly   189 KLLEFTNAPRHVNFFLNTFRIFMTPKIRSRLFVRREG-----TSVSCDQLPKELGGQGLSYMELS 248
            |.:...|.....|.....|:.|:..|:|.|:|...:.     :.:....||.:.||        |
  Fly   217 KAVHIVNNSYIFNMLFAVFKPFIREKLRKRIFFHGKDYKSLISHIEAKALPPKYGG--------S 273

  Fly   249 VKW-----KQLVE---------ENADFYVEQDKYKSK 271
            ..|     |.|.|         |.||.|...:.||.|
  Fly   274 ATWELPHGKVLGEFFECYSKDYELADSYGYTEGYKMK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 32/162 (20%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 12/48 (25%)
SEC14 116..272 CDD:238099 31/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.