DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and CG5958

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:116/262 - (44%) Gaps:22/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DPERVLAQ-VQDLSDWLVANPQINGCNTFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEWFD 81
            :.|.|.|: :..|.:.|.|.|::|..:....|..|||...|..|.|.:|:||....|.|..... 
  Fly    32 ETEEVKAEAIIKLRELLKATPELNYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEYASLV- 95

  Fly    82 NRDPQLPEIQDLLKLGVFLPIGPDAEQ---RMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKL 143
             |...:.::::....|..:.:..:.:|   |:::|......||...:.:.:|:...|: .|..:|
  Fly    96 -RGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLYMV-HLAAQL 158

  Fly   144 DPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVE-SWTAYPCQPKLLEFTNAPRHVNFFLNTF 207
            :.||..||:|.|:|.:|:.:.....::|...||.:. ...|.|.:.|.:.|...|...|...:.|
  Fly   159 EEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLF 223

  Fly   208 RIFMTPKIRSRLFVRREGTSVSCDQ-------LPKELGG--QGLSYMELSVKWKQLVEENADFYV 263
            :.|:..|:.:|:..  .|:.:...|       ||....|  ..:.|.  .|:|...:|:.|. ||
  Fly   224 KPFVKQKLNNRMHF--HGSDMKSLQKFLDPSVLPANYKGTLPAIDYG--GVEWFPALEQQAQ-YV 283

  Fly   264 EQ 265
            |:
  Fly   284 EE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 36/165 (22%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 14/43 (33%)
CRAL_TRIO 111..261 CDD:279044 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.