DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and retm

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:277 Identity:57/277 - (20%)
Similarity:102/277 - (36%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSSKRQVATTDGD-PERVLAQVQDL--SDWLVANPQINGCN------TFENLHFFLRTSKFDVER 61
            :|.::.....||| ..|.|.|:..:  |..|.....::|.:      :::.:..||....:.|.:
  Fly   196 ASDQQHSILLDGDFIARSLGQLSPMQESKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQ 260

  Fly    62 AKKKLKTFYQMRAERTEWFDNRDPQLPE-IQDLLKLGVFLPIGP------DAEQRMVVVIRTAAH 119
            |       |.|..:...|  .|:.::.. :.:..|..|.:...|      |.:.|.|.::|....
  Fly   261 A-------YAMLCDSLRW--RREHRIDALLAEYSKPAVVVEHFPGGWHHLDKDGRPVYILRLGHM 316

  Fly   120 DPKLHSQNNVFKTSKMILDLLLKLDPETCARGMVAI-----------------LDMQGVQLGHAL 167
            |.|     .:.|:..|  |.||:|....|..|:..|                 :|::|:.:.|..
  Fly   317 DVK-----GLLKSLGM--DGLLRLALHICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLW 374

  Fly   168 QMNPKLIKRSVESWTA-YPCQPKLLEFTNAPRHVNFFLNTFRIFMTPKIRSR-LFV------RRE 224
            :...|.:...:|:... ||.....:....|||...........|:....||: ||.      .::
  Fly   375 RPGIKALLNIIETVERNYPETMGRVLVVRAPRVFPIAWTIVSAFIDEHTRSKFLFYGPDCAHMKD 439

  Fly   225 GTSVSCDQ--LPKELGG 239
            |.:...|:  :|..|||
  Fly   440 GLAQYLDEEIVPDFLGG 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 39/187 (21%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 9/52 (17%)
CRAL_TRIO 293..456 CDD:279044 35/169 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.