DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pinta and ttpa

DIOPT Version :9

Sequence 1:NP_001287466.1 Gene:pinta / 42635 FlyBaseID:FBgn0038966 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_956025.2 Gene:ttpa / 325906 ZFINID:ZDB-GENE-030131-4631 Length:285 Species:Danio rerio


Alignment Length:270 Identity:74/270 - (27%)
Similarity:120/270 - (44%) Gaps:46/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DPERVLAQVQDLSDWLVANPQINGCN---TFENLHFFLRTSKFDVERAKKKLKTFYQMRAERTEW 79
            |..|:...:.:|.:...|..:|...:   ||  |..||:...|||..|.|.|..:::.|.|    
Zfish    18 DSSRIAPYLSELKEKAEAELRIRDLDLSKTF--LIRFLQARDFDVALALKLLINYHKWRQE---- 76

  Fly    80 FDNRDPQLPEIQDLLK----LGVF-------LPIGPDAEQRMVVVIRTAAHDPKLHSQNNVFKTS 133
                   .|||...|:    :|:.       |....||..| |::.|....:||..:...||:.|
Zfish    77 -------CPEITADLRPSSVIGLLQNNYHGVLRSRDDAGSR-VLIYRIGKWNPKEFTAYEVFRVS 133

  Fly   134 KMILDLLLKLDPETCARGMVAILDMQGVQLGHALQMNPKLIKRSVESWT-AYPCQPKLLEFTNAP 197
            .:..:|::: :.||...|:.||.|:|.....||||:||.|.|:.....| ::|.:.:.:...|.|
Zfish   134 LITSELIVQ-EWETQRNGLKAIFDLQDWCFAHALQINPSLAKKISSVLTDSFPLKVRGIHLINEP 197

  Fly   198 RHVNFFLNTF---RIFMTPKIRSRLFVRREGTSVS---CDQLPKEL-----GGQGLSYMELSVKW 251
               .||...|   |.|:..||:.|  :...|.|.:   |:..||.:     ||.|.|..|:..:|
Zfish   198 ---IFFRPVFAMIRPFLPDKIKQR--IHMHGCSYARSLCNYFPKAVLPPVYGGTGPSVDEVCQEW 257

  Fly   252 KQLVEENADF 261
            .:.:.::.|:
Zfish   258 TEYIMQSEDY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pintaNP_001287466.1 SEC14 87..240 CDD:238099 50/175 (29%)
ttpaNP_956025.2 CRAL_TRIO_N 26..70 CDD:215024 14/45 (31%)
CRAL_TRIO 97..246 CDD:279044 45/155 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.